Skip to main content

Table 2 Protein annotation in the grapevine fully developed leaves (V1-V15), cork oak ectomycorrhizal roots (S1-S20) and pine needles (P1-P14) spots excised from 2-DE gels and trypsin-digested

From: A possible approach for gel-based proteomic studies in recalcitrant woody plants

Spot Protein ID Annotation Score Search engine Protein score Sequence of the distinct fragmented peptides (p < 0,05)
V1 8615601 cyclase [Vitis pseudoreticulata] 532 ProteinPilot 14 EFESDYAGFTEDGAR
EVILVESLK
KEFESDYAGFTEDGAR
LDDVPAGMYNVHCLHLR
LPGAEGAPIR
SEAYPSAYGSGSCNVELIPVKR
WLVENTDIK
EFESDYAGFTEDGAR
GPALLVDAPR
LPGAEGAPIR
V2 49388156 putative chlorophyll a/b-binding protein type III precursor [Oryza sativa Japonica Group] 270 ProteinPilot 10.67 FQDWANPGSMGK
QGADRPLWFASK
QSLTYLDGSLPGDYGFDPLGLSDPEGTGGFIEPR
QYFLGLEK
WLAYGEVINGR
RFQDWANPGSMGK
LKEVKNGR
QGADRPLWFASK
QYFLGLEK
RFQDWANPGSMGK
WLAYGEVINGR
V3 225446775 oxygen-evolving enhancer protein 2, chloroplastic [Vitis vinifera] 449 ProteinPilot 2.13 SITDYGSPEEFLSK
TNTDFLPYNGEGFK
EFPGQVLR
V4 73647738 ascorbate peroxidase [Vitis pseudoreticulata]   ProteinPilot 9.32 ALLSDPAFRPLVEK
EDKPEPPPEGR
NCAPIMLR
SYPTVSEEYKK
TGGPFGTMK
EDKPEPPPEGR
NCAPIMLR
V5 349048 ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Pogostemon cablin]   MASCOT 121.49 TFKGPPHGIQVER
V6 225460496 PREDICTED: ATP synthase delta chain, chloroplastic [Vitis vinifera]   MASCOT 154.41 LESEHLAQIAK
TAIDPSLVAGFTIR
EIAKEFELVYNR
V7 225461287 PREDICTED: cytochrome b6-f complex iron-sulfur subunit, chloroplastic isoform 1 [Vitis vinifera]   MASCOT 234.97 GDPTYLVVENDK
DALGNDVIADEWLK
FICPCHGSQYNNQGR
V8 22797822 ATP synthase epsilon subunit [Vitis vinifera]   MASCOT 258.01 TRVEAINVTS
QIIEANLALR
IGNNEITVLVNDAEK
LNDQWLTMALMGGFAR
V9 359475330 PREDICTED: glycine-rich RNA-binding protein GRP1A-like [Vitis vinifera]   MASCOT 313.75 DRGYGDGGSR
NITVNEAQSR
AFSQFGEILESK
GGGGGYGGGGGGYGGGSR
GFGFVTFSSEQSMR
CFVGGLAWATDDQSLER
V10 225468761 oxygen-evolving enhancer protein 1, chloroplastic [Vitis vinifera] 610 MASCOT 984.17 VPFLFTIK
RLTYDEIQSK
FGGEFLVPSYR
FCLEPTSFTVK
KFCLEPTSFTVK
DGIDYAAVTVQLPGGER
GTGTANQCPTIDGGVDSFAFK
FEEKDGIDYAAVTVQLPGGER
SKPETGEVIGVFESIQPSDTDLGAK
V11 225459768 plastocyanin, chloroplastic isoform 1 [Vitis vinifera] 331 MASCOT 453.18 GTYSFYCSPHQGAGMVGK
ISMSEEDLLNAPGEVYSVTLTEK
NNAGFPHNVVFDEDEVPSGVDVSK
V12 30687535 Quinone reductase family protein [Arabidopsis thaliana] 393 MASCOT 62.96 AFLDATGGLWR
V13 225456238 PREDICTED: glutamine synthetase cytosolic isozyme 1[Vitis vinifera]   MASCOT 183.79 VIVEYIWVGGSGMDLR
GNNILVMCDTYTPAGEPIPTNKR
V14 359473178 Quinone oxidoreductase-like protein At1g23740, chloroplastic-like [Vitis vinifera] 612 MASCOT 460.41 VKPVVDPK
LNPYLESGK
KLNPYLESGK
VVAAALNPVDAK
AWVYGDYGGVDVLK
QFGSFAEYTAVEEK
EGGSVVALTGAVTPPGFR
ELKEGDEVYGDINEK
ATDSPLPTVPGYDVAGVVVK
V15 225432496 PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Vitis vinifera]   MASCOT 349.06 DISDAHYK
AAEIFGNKK
EHISAYGEGNER
TISKPVEHPSELPK
HKEHISAYGEGNER
HETANINTFSWGVANR
GGNNILVICDSYTPAGEPIPTNKR
S1 4838443 symbiosis regulated acidic polypeptide SRAP32-3 [Pisolithus tinctorius]   Protein Pilot 4 DKLEAKLDKAAGDYIDGVDI
TDVANSLEFASR
S2 160897637 hypothetical protein Daci_2194 [Delftia acidovorans SPH-1]   MASCOT 59.58 ERAQSAAAIER
S3 71659717 hypothetical protein [Trypanosoma cruzi strain CL Brener]   MASCOT 58.93 KDIAEEVLER
S4 20162432 AF493154_1 32 kDa-cell wall symbiosis regulated acidic polypeptide [Pisolithus microcarpus]   MASCOT 80.35 NDPLYSEAEK
S5 71659717 hypothetical protein [Trypanosoma cruzi strain CL Brener]   MASCOT 57 KDIAEEVLER
S6 20162434 32 kDa-cell wall symbiosis regulated acidic polypeptide precursor [Pisolithus microcarpus] 358 MASCOT 210.62 ATGDDYAR
NSLEFAAR
FQLAVCSEK
AADKATGDDYAR
S7 390601324 cysteine peroxiredoxin [Punctularia strigosozonata HHB-11173SS5] 391 MASCOT 334.84 NFDEVLR
TVFVIDPK
LTISYPASTGR
VVDSLQLGDKYR
LGSIAPDFEAETTAGPIK
ISTLYDMLDEQDATNR
S8 225461209 PREDICTED: flavoprotein wrbA isoform 1 [Vitis vinifera]   MASCOT 383.52 GAASVEGVEAK
KGAASVEGVEAK
AFLDATGGLWR
GGSPYGAGTFAGDGSR
VKGGSPYGAGTFAGDGSR
VYIVYYSMYGHVEK
S9 20097 jgi|Pisti1|20097|gm1.2716_g   MASCOT 54.44 NPDIQAPR
S10 218533914 serine proteinase inhibitor [Clitocybe nebularis] 50.1 MASCOT 119.09 AQEWVIR
YRELQDAYTIVK
S11 20097 jgi|Pisti1|20097|gm1.2716_g   MASCOT 302.72 VFAVMEGR
LDEPGEIGWIAPTDGSSQIR
RLDEPGEIGWIAPTDGSSQIR
EIPTAPPGQYRPEELYNLAFPLE
S12 218533914 serine proteinase inhibitor [Clitocybe nebularis] 50.1 MASCOT 89.1 AQEWVIR
ELQDAYTIVK
YRELQDAYTIVK
S13 20097 jgi|Pisti1|20097|gm1.2716_g   MASCOT 343.22 LDEPGEIGWIAPTDGSSQIR
RLDEPGEIGWIAPTDGSSQIR
EIPTAPPGQYRPEELYNLAFPLE
S14 33323059 major latex protein [Ficus pumila var. awkeotsang] 187 MASCOT 485.65 GIDEHITKA
LREDVPAPDK
EKVEYDDANR
SPPEKYYNIFK
SATLIGVDGDIMQEYK
GQAYHVPNAAPDHIQGVDVHEGDWETHGSVK
S15 3164115 major latex-like protein [Rubus idaeus]   MASCOT 68.2 EKVELDDVNK
S16 Q9S1X8 Na(+)/H(+) antiporter NhaA 1/4[Streptomyces coelicolor strain ATCC BAA-471/A3(2)/M145]   MASCOT 483.67 NDAYVIAK
EEREEER
GVGWVAPSPENK
VGECTYVISAR
SVTEPPTFNMEK
KSVTEPPTFNMEK
GVGWVAPSPENKEER
S17 375333787 lectin 2 [Agrocybe aegerita] 565 MASCOT 647.19 FLGEATGDGR
FVVDLTGDGR
DFAYSAGGWR
DGFSIQPFVAIK
ADIVGFGDGGVLVSK
SVIDNFTYSAGGWR
FVLNNFGVQQGWQVNK
NTGGGNFSPASLALNDFGYNAGGWR
S18 392590852 phosphoglycerate mutase-like protein [Coniophora puteana] 540 MASCOT 431.54 VYASPEFK
DIGGIGNLPGR
TAQPFFGAIR
LPPTLIEQAR
GPAPEDRDFLR
ADIPLTEFFYR
SVYLSPSSPSYITNMK
S19 160184939 Serine protease inhibitor [Lentinula edodes (Shiitake mushroom)] 58.9 MASCOT 106.97 WCIQYTER
VGDCTYVISAR
S20 1001331 jgi|Pisti1|1001331|fgenesh1_kg.33_#_73_#_Locus10529v3rpkm0.40_PRE   MASCOT 205.69 YYINYLIER
WIITFVPQPGR
NNLLYEQVTAPQK
P1 332591479 phosphoglycerate kinase 1 [Pinus pinaster]   MASCOT 260.9 AHASTEGVTK
LTELLGVNVVK
ELDYLVGAVSNPK
ADLNVPLDENQNITDDTR
P2 396547 glutamate-ammonia ligase [Pinus sylvestris]   MASCOT 134.75 SLSGPVSSVK
VIAEYIWIGGSGMDMR
P3 218155 chloroplastic aldolase [Oryza sativa Japonica Group]   MASCOT 129.98 EAAWGLAR
AKANSLAQLGK
LASIGLENTEANR
P4 3415126 phenylcoumaran benzylic ether reductase [Pinus taeda]   MASCOT 497.86 VVILGDGNAR
SLAQAGLTAPPR
ILLIGATGYIGR
DKVVILGDGNAR
ASLDLGHPTFLLVR
FFPSEFGNDVDNVHAVEPAK
GDQTNFEIGPAGVEASQLYPDVK
AIEAEGIPYTYVSSNCFAGYFLR
P5 413951269 ferredoxin-NADP reductase, leaf isozyme [Zea mays] 768 MASCOT 388.09 KDNTYVYMCGLK
RLVYTNDQGEIVK
LYSIASSALGDFGDSK
ITGDDAPGETWHMVFSTEGEIPYR
P6 359473184 carbonic anhydrase, chloroplastic-like isoform 2 [Vitis vinifera] 299 MASCOT 109.34 FMVVACADSR
QTAFIEDWIK
P7 359473184 carbonic anhydrase, chloroplastic-like isoform 2 [Vitis vinifera] 299 MASCOT 107.77 FMVVACADSR
QTAFIEDWIK
P8 14719331 putative 3-beta hydroxysteroid dehydrogenase/isomerase protein [Oryza sativa] 496 MASCOT 245.13 MKPGFDPSK
IGGGDDVFVGDIR
AEQYLADSGLPYTIIR
KAEQYLADSGLPYTIIR
P9 116790330 unknown [Picea sitchensis]   MASCOT 104.32 TTFLSDSEVK
TTFLSDSEVKR
P10 116782111 unknown [Picea sitchensis]   MASCOT 220.45 EYYNISVLTR
YEDNGDTVSNVSVMVIPTDKK
P11 16798638 AF434186_1 Cu-Zn-superoxide dismutase precursor [Pinus pinaster]   MASCOT 234.71 LTHGAPEDDVR
KLTHGAPEDDVR
GGHELSLTTGNAGGR
GNSQVEGVVNLSQEDNGPTTVK
P12 2911276 LMW heat shock protein [Fragaria x ananassa] 103 MASCOT 105.95 QPEPQPPQPK
ASMEDGVLTVTVPK
P13 413946843 Putative peptidyl-prolyl cis-trans isomerase family protein [Zea mays] 307 MASCOT 138.86 TFEDENFK
KLESEETNR
IVLGLFGEDVPK
P14 20794 Type III chlorophyll a/b-binding protein [Pinus sylvestris] 259 MASCOT 268.1 LQDYRNPGSMGK
YLGGSGNPAYPGGPLFNPLGFGK
  YLGGSGNPAYPGGPLFNPLGFGKDEK
  1. (Protein annotations retrieved from NCBI protein database restricted to Viridiplantae, to Vitis , to Agaricomycotina, JGI Pisolithus tinctorius manual and NCBI Blastp).